PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J02212.1.p
Common NameEUGRSUZ_J02212, LOC104423904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 212aa    MW: 24322.3 Da    PI: 9.4763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J02212.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding621.2e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT+eEd++l+++v+  G+g W+tIa+++g++R++k+c++rw +yl
  Eucgr.J02212.1.p 14 KGLWTEEEDKILIHYVEANGKGKWNTIAKRIGLRRCGKSCRLRWMNYL 61
                      678*******************************************97 PP

2Myb_DNA-binding60.24.3e-1967112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       r+++++eE++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Eucgr.J02212.1.p  67 RDSFSEEEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112
                       789*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.82961IPR017930Myb domain
SuperFamilySSF466893.45E-3112108IPR009057Homeodomain-like
SMARTSM007174.2E-161363IPR001005SANT/Myb domain
PfamPF002493.7E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-241568IPR009057Homeodomain-like
CDDcd001677.11E-121761No hitNo description
PROSITE profilePS5129428.20262116IPR017930Myb domain
SMARTSM007179.9E-1966114IPR001005SANT/Myb domain
PfamPF002495.4E-1867112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2769116IPR009057Homeodomain-like
CDDcd001674.14E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAKATNGREN ERKKGLWTEE EDKILIHYVE ANGKGKWNTI AKRIGLRRCG KSCRLRWMNY  60
LSPDVKRDSF SEEEEDLIIR LHKLLGNRWS LIAKRVPGRT DNQVKNYWNT HLSKKLGVQV  120
HSARSSTSAS SRSLQPSSTS TYPCSTSSHD AASEKKLDKD ARPDCTKWDT REPTIRDQST  180
SHFWDFESEL GELGMMEFLQ GQCRDLSWLN S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-301111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J02212.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034640.11e-157PREDICTED: transcription factor MYB23-like
SwissprotQ962764e-70MYB23_ARATH; Transcription factor MYB23
TrEMBLA0A059AFQ61e-157A0A059AFQ6_EUCGR; Uncharacterized protein
STRINGAT5G40330.11e-67(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-65myb domain protein 66